PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_69621.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family NAC
Protein Properties Length: 90aa    MW: 9899.92 Da    PI: 4.0946
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_69621.3genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM51.43.6e-164590248
           NAM  2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp 48
                  +pGfrFhPt+eel+ +yL++kveg+++++ e i+ +d+y+++Pw+Lp
  MLOC_69621.3 45 MPGFRFHPTEEELIEFYLRRKVEGRRFNV-ELITFLDLYRFDPWELP 90
                  79***************************.89**************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100520.3174490IPR003441NAC domain
SuperFamilySSF1019412.22E-164490IPR003441NAC domain
PfamPF023658.3E-84686IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 90 aa     Download sequence    Send to blast
MSRDIDEGSV SAATAGGGGG EVGGEPAAGV GDEAAVDSHE NDLVMPGFRF HPTEEELIEF  60
YLRRKVEGRR FNVELITFLD LYRFDPWELP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-1446901761Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703061e-125HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010231368.13e-39PREDICTED: protein FEZ isoform X2
RefseqXP_014753810.13e-39PREDICTED: protein FEZ isoform X1
SwissprotQ9SK553e-19NAC42_ARATH; Transcription factor JUNGBRUNNEN 1
SwissprotQ9ZVH03e-19FEZ_ARATH; Protein FEZ
TrEMBLM0YID07e-59M0YID0_HORVD; Uncharacterized protein
TrEMBLM0YID17e-58M0YID1_HORVD; Uncharacterized protein
TrEMBLM0YID22e-59M0YID2_HORVD; Uncharacterized protein
STRINGMLOC_69621.22e-57(Hordeum vulgare)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02450.27e-29NAC domain containing protein 35